Update README.md

README.md

@@ -1,20 +1,24 @@
 # moPPIt: De Novo Generation of Motif-Specific Peptide Binders via Multi-Objective Discrete Flow Matching
 
-<img src="https://cdn-uploads.huggingface.co/production/uploads/649ef40be56dc456b7a36649/2P-06_gxQ_Dv3x-i1aEWH.png" width="80%">
+<img src="https://cdn-uploads.huggingface.co/production/uploads/649ef40be56dc456b7a36649/2P-06_gxQ_Dv3x-i1aEWH.png" width="100%">
 
 Targeting specific functional motifs, whether conserved viral epitopes, intrinsically disordered regions (IDRs), or fusion breakpoints, is essential for modulating protein function and protein-protein interactions (PPIs). Current design methods, however, depend on stable tertiary structures, limiting their utility for disordered or dynamic targets. Here, we present a motif-specific PPI targeting algorithm (moPPIt), a framework for the de novo generation of motif-specific peptide binders derived solely from target sequence data. The core of this approach is BindEvaluator, a transformer architecture that interpolates protein language model embeddings to predict peptide-protein binding site interactions with high accuracy (AUC = 0.97). We integrate this predictor into a novel Multi-Objective-Guided Discrete Flow Matching (MOG-DFM) framework, which steers generative trajectories toward peptides that simultaneously maximize binding affinity and motif specificity. After comprehensive in silico validation of binding and motif-specific targeting, we validate moPPIt in vitro by generating binders that strictly discriminate between the FN3 and IgG domains of NCAM1, confirming domain-level specificity, and further demonstrate precise targeting of IDRs by generating binders specific to the N-terminal disordered domain of β-catenin. In functional, disease-relevant assays, moPPIt-designed peptides targeting the GM-CSF receptor effectively block macrophage polarization. Finally, we demonstrate therapeutic utility in cell engineering, where binders directed against the tumor antigen AGR2 drive specific CAR T regulatory cell activation. In total, moPPIt serves as a purely sequence-based paradigm for controllably targeting the "undruggable" and disordered proteome.
 
-## Google Colab Notebooks
+---
+
+## 1. Google Colab Notebooks
 We provide two Google Colab notebooks to help you run and evaluate moPPIt without any local setup:
 
 - **moPPIt Colab** (Generating motif-specific binders while optimizing other therapeutic-related properties): [Link](https://colab.research.google.com/drive/16n8PIwKwAiG-oDLm171BWvv-lQH0dHMg?usp=sharing)
 
 - **PeptiDerive Colab** (Computing Relative Interaction Scores (RIS) for residues on the target protein): [Link](https://colab.research.google.com/drive/1aCODZ-WRwhxr-u8nEB6ZrdrhIOTz7-UF?usp=sharing)
 
-## Command-line Usage
+---
+
+## 2. Command-line Usage
 You can also run **moPPIt** and **BindEvaluator** from the command line. 
 
-### Run moPPIt
+### 2.1 Run moPPIt
 
 Example command:
 ```
@@ -29,7 +33,7 @@ python -u moo.py \
 --target_protein MHVPSGAQLGLRPDLLARRRLKRCPSRWLCLSAAWSFVQVFSEPDGFTVIFSGLGNNAGGTMHWNDTRPAHFRILKVVLREAVAECLMDSYSLDVHGGRRTAAG
 ```
 
-### Run BindEvaluator
+### 2.2 Run BindEvaluator
 BindEvaluator predicts the binding sites on the target protein, given a target protein seqeunce and a binder sequence. 
 
 Example command: